PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400042630
Common NameLOC102583376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28411.2 Da    PI: 8.8752
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400042630genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  PGSC0003DMP400042630  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                          79***********************************************96 PP

2K-box99.74.1e-33811737100
                 K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                           + ++ +++++ ++e+ +Lk+++e Lqr+qR++lGedL++L+ k+L+qLe+qLe+slk+iRs+K++++l+q+ +lq+ke++l e n+ Lr
  PGSC0003DMP400042630  81 N-QSVTETQNNYHEYLRLKARVELLQRSQRNFLGEDLGTLNTKDLEQLENQLESSLKQIRSRKTQFMLDQLADLQQKEQMLAESNRLLR 168
                           3.577889********************************************************************************* PP

                 K-box  96 kklee 100
                           +klee
  PGSC0003DMP400042630 169 RKLEE 173
                           **987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
CDDcd002656.21E-45278No hitNo description
SuperFamilySSF554554.06E-34284IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-333859IPR002100Transcription factor, MADS-box
PfamPF014864.8E-2884171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.97387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0048440Biological Processcarpel development
GO:0048441Biological Processpetal development
GO:0048442Biological Processsepal development
GO:0048443Biological Processstamen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
SSMVKTIEKY QRCSYATLEA NQSVTETQNN YHEYLRLKAR VELLQRSQRN FLGEDLGTLN  120
TKDLEQLENQ LESSLKQIRS RKTQFMLDQL ADLQQKEQML AESNRLLRRK LEESAAGFPL  180
RLCWEDGAEH QAMHQQNRLP NTEGFFQPLG LHSSSPHFGY NPVNTDEVNA AATAHNMNGF  240
IHGWML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-289217122101Developmental protein SEPALLATA 3
4ox0_B3e-289217122101Developmental protein SEPALLATA 3
4ox0_C3e-289217122101Developmental protein SEPALLATA 3
4ox0_D3e-289217122101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00030SELEXTransfer from AT2G03710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2943290.0AY294329.1 Lycopersicon esculentum MADS-box protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345102.10.0PREDICTED: MADS-box protein CMB1-like
SwissprotQ396851e-109CMB1_DIACA; MADS-box protein CMB1
TrEMBLM1CAG70.0M1CAG7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000633150.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.13e-90MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]